Product Added to your Cart
x

-------- OR --------

AUD
AEDAFNALLAMDANGAOAARSAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
$0.00
Pants suits / Jumpsuits Collection

Modern pantsuits and elegant jumpsuits designed for confident, effortless style—perfect for any occasion.

Pants suits / Jumpsuits Collection
Jewel Embellishments Ruched Jumpsuit Style
Jewel Embellishments Ruched Jumpsuit Style
$489.00
Pant suit with stretch
Pant suit with stretch
$489.00
Jumpsuit
Jumpsuit
$339.00
Black Jumpsuit
Black Jumpsuit
$329.00
Red Jumpsuit
Red Jumpsuit
$329.00
Chiffon pant suit with camisole
Chiffon pant suit with camisole
$489.00
Chiffon pant suit with camisole
Chiffon pant suit with camisole
$489.00
Chiffon pant suit with stretch sequin camisole
Chiffon pant suit with stretch sequin camisole
$489.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i